PTN/PTPRZ1 signalling alters the phosphorylation state of key regulators of cell migration
| Protein | Peptide(s) | Ascore (%) |
|---|---|---|
| Afadin | (K)QGAIYHGLATLLNQPSPmmQR(I) | >99 |
| (R)SSPNVANQPPSPGGK(G) | >99 | |
| DLQYITISKEELSSGDSLSPDPWKR | >50 | |
| Paxillin | RPVFLSEEPPYSYPTGNHTYQEIAVPPPVPPPPSSEALN!GTVLDPLDQWQPSGSR | >80 |
| Supervillin | (R)SISFPEVPRSPK(Q) | >90 |
| (K)QIPSSPLQQPASPNHPGDSPLPTEAR(A) | >99 | |
| (R)EmEKSFDEHTVPK(R) | >99 | |
| (R)RGSLELGNPSAAHLGDELK(E) | >99 | |
| Talin | ALDYYMLR | >80 |
| Tensin | HVAYGGYSTPEDR | >90 |
| HVAYGGYSTPED | >80 | |
| SYSPYDYQLHPAASNQSFRPK | >50 |
MF-HSC were treated with vehicle (PBS; PTN) or PTN (100 ng/mL) for 3 h under serum free conditions. Whole cell extracts were prepared and phosphopeptides identified by LC-MS/MS following protein or peptide phosphotyrosine immunoprecipitations. High-resolution spectra were annotated at a 1.0% false discovery rate within Scaffold following Mascot database searching versus a SwissProt_Mouse forward/decoy database. Unique PTN-induced phosphopeptides relative to control are provided. Probability of phosphorylation localisation was calculated using AScore algorithm. Lower case ‘m’ designates oxidation on Met.
MF-HSC, myofibroblastic-hepatic stellate cells; PTN, pleiotrophin; PTPRZ1, protein tyrosine phosphatase receptor zeta-1.