Table 1

Sequences of the seven peptides identified in Faecalibacterium prausnitzii supernatant and sequence of the microbial anti-inflammatory molecule protein

Pep11732.95 DaGNTFLQSTINRTIGVL
Pep21832.02 DaVGNTFLQSTINRTIGVL
Pep31945.10 DaLVGNTFLQSTINRTIGVL
Pep42046.15 DaTLVGNTFLQSTINRTIGVL
Pep52145.26 Da VTLVGNTFLQSTINRTIGVL
Pep64600.28 Da FSGNTTWKEVGNIGKNLFGTNVKGNPIEKNNFGDYAMNALGIA
Pep72578.40 Da AAVYNLGVA PTKNTVKETE VKFTV
Protein
ZP 05614546.1
 MMMPANYSVIAENEMTYVNGGANFIDAIGAVTAPIWTLDNVKTFNTNIVTLVGNTFLQSTINRTIGVLFSGNT TWKEVGNIGKNLFGTNVKGNPIEKNNFGDYAMNALGIAAAVYNLGVA PTKNTVKETEVKFTV